My software notes

March 6, 2008

[IDP] Pro-domain of Subtilisin

Filed under: IDP — kpwu @ 9:14 pm
Tags: ,
  • Title:  Backbone dynamics of the natively unfolded pro-peptide of subtilisin by heteronuclear NMR relaxation studies
  • Journal: J Biomol NMR. 2001 Jul;20(3):233-49.
  • DOI:10.1023/A:1011243116136
  • Author: Alexei V. Buevich, Ujwal P. Shinde, Masayori Inouye and Jean Baum
  • number of AA: 77
  • Sequence:
    AGGSTKEKKYIVGFKQTMSAMSSAKKKDVISQKGGKVEKQ
    FKYVNAAAATLDEKAVKELKKDPSVAYVEEDHIAHEY
  • BMRB code: not deposited

HSQC or other spectra

propeptide.jpg

No Comments Yet »

No comments yet.

RSS feed for comments on this post. TrackBack URI

Leave a comment

Blog at WordPress.com.