[IDP]ENSA- cAMP-regulated phosphoprotein endosulfine-alpha

• Title: ¹H, ¹³C, and ¹⁵N resonance assignment of the cAMP-regulated phosphoprotein endosulfine-alpha in free and micelle-bound states
• Journal: Biomolecular NMR Assignments
• DOI: 10.1007/s12104-007-9063-7
• Author:John M. Boettcher, Kevin L. Hartman, Daniel T. Ladror, Zhi Qi, Wendy S. Woods, Julia M. George and Chad M. Rienstra1
• number of AA:121
• Sequence:
  MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAK
  YPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNK
  QLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE
• BMRB code: 15136

HSQC or other spectra: