My software notes

March 3, 2008

[IDP] MBP –murine myelin basic protein

Filed under: IDP — kpwu @ 10:22 pm
Tags: ,
  • Title:MR assignment of an intrinsically disordered protein under physiological conditions: the 18.5 kDa isoform of murine myelin basic protein
  • Journal: Biomolecular NMR Assignments
  • DOI: 10.1007/s12104-007-9016-1
  • Author:David S. Libich, Martine M. Monette, Valerie J. Robertson and George Harauz1
  • number of AA:176 (with extra H6 in C-term)
  • Sequence:
    ASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGILDSIG
    RFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRTQDE
    NPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRP
    GFGYGGRASDYKSAHKGFKAYDAQGTLSKIFKLGGRDSR
    SGSPMARRLEHHHHHH
  • BMRB code: 15131
  • additional info:
    Solution NMR and CD spectroscopy of an intrinsically disordered, peripheral membrane protein: evaluation of aqueous and membrane-mimetic solvent conditions for studying the conformational adaptability of the 18.5 kDa isoform of myelin basic protein (MBP), European Biophysics Journal,Volume 37, Number 6 / July, 2008, 1015-1029

HSQC or other spectra:

bmrb 15131

No Comments Yet »

No comments yet.

RSS feed for comments on this post. TrackBack URI

Leave a comment

Blog at WordPress.com.